PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G0544
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 378aa    MW: 42686.8 Da    PI: 7.4442
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G0544genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.34.8e-1581128148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEd++l+  +   G  +W+++++  g+ R++k+c++rw +yl
      Gh_D12G0544  81 KGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 128
                      79******************************99************97 PP

2Myb_DNA-binding51.22.9e-16138178547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
      Gh_D12G0544 138 SEYEEQMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 178
                      6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-2072130IPR009057Homeodomain-like
PROSITE profilePS5129413.53376128IPR017930Myb domain
SuperFamilySSF466899.73E-2778175IPR009057Homeodomain-like
SMARTSM007173.3E-1280130IPR001005SANT/Myb domain
PfamPF002493.8E-1481128IPR001005SANT/Myb domain
CDDcd001671.13E-883128No hitNo description
PROSITE profilePS5129426.341129183IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-24131183IPR009057Homeodomain-like
SMARTSM007172.5E-14133181IPR001005SANT/Myb domain
PfamPF002495.5E-14138178IPR001005SANT/Myb domain
CDDcd001676.53E-11141179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MKVGACVCAL LLSVHQTSKR VPVSCSCFIS WINCFVLIIS FHFLDKVLIF LRNPLFDKTL  60
VFNIHIKMGR QPCCEKVGLK KGPWTAEEDK KLISFILTNG QCCWRAVPKL AGLLRCGKSC  120
RLRWTNYLRP DLKRGLLSEY EEQMVIDLHA QLGNRWSKIA SHLPGRTDNE IKNHWNTHIK  180
KKLRKMGIDP LTHKPLSTAE EQPKEQKKQV PKVDKSKPPE TSLQSTITKA KEEDTSMTSS  240
SFDPMDMTMN NENIDGFCTD EVPLIEPHEV LIPGPAAPST SASSSSSSSS SSSSAHSPNF  300
LQQFHYFPAD FEWPSVNNTN KTDSNNLSLW DTDDFSGWDL LINDDDSDTK LALNSLSSPL  360
FQCLRMGFDQ DSWTYPLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28791835108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.37970.0ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO738628040.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0958311e-124BT095831.1 Soybean clone JCVI-FLGm-19P8 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012436774.10.0PREDICTED: protein ODORANT1-like
TrEMBLA0A0D2RAD80.0A0A0D2RAD8_G
STRINGPOPTR_0017s02850.11e-119(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.11e-96myb domain protein 43